PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009591137.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 322aa    MW: 36751 Da    PI: 9.5997
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009591137.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.51.8e-55181441129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL kkv ++++ +  +i evd++kvePwdLp k+k +ekewyfF+ rdkky+tg r+nrat++gyWkatgkdke+++ 
  XP_009591137.1  18 LPPGFRFHPTDEELITHYLSKKVVDNNFFA-IAIGEVDMNKVEPWDLPWKAKMGEKEWYFFCVRDKKYPTGLRTNRATAAGYWKATGKDKEIFR- 110
                     79*************************877.78***************888999****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +++lvg+kktLvfy+grapkgekt+Wv+heyrle
  XP_009591137.1 111 GKSLVGMKKTLVFYRGRAPKGEKTNWVIHEYRLE 144
                     999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-6115169IPR003441NAC domain
PROSITE profilePS5100557.74818169IPR003441NAC domain
PfamPF023651.0E-2819143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MENILGPVVK EEDQQLQLPP GFRFHPTDEE LITHYLSKKV VDNNFFAIAI GEVDMNKVEP  60
WDLPWKAKMG EKEWYFFCVR DKKYPTGLRT NRATAAGYWK ATGKDKEIFR GKSLVGMKKT  120
LVFYRGRAPK GEKTNWVIHE YRLEGRLSLQ NLPKTAKQND WVISRVFYKS TGGNKVHISG  180
LMRLNSTEIE MGNSVLPTLK DSESSHVHCF SNFVSAQKSQ KEMTNCFNIS TSIPSLPNKF  240
ALNQTLPPQG NLLNPGSFPM QGPPSLRNLY QNHGQNMVQN LKKEKEIVSL SQETVVSTDM  300
NNEFFSSAAV VGPQYLDYLW NY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-5491756171NO APICAL MERISTEM PROTEIN
1ut4_B3e-5491756171NO APICAL MERISTEM PROTEIN
1ut7_A3e-5491756171NO APICAL MERISTEM PROTEIN
1ut7_B3e-5491756171NO APICAL MERISTEM PROTEIN
4dul_A3e-5491756171NAC domain-containing protein 19
4dul_B3e-5491756171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5102150.0AF510215.1 Petunia x hybrida nam-like protein 18 (NH18) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591137.10.0PREDICTED: NAC domain-containing protein 100-like isoform X1
RefseqXP_016451616.10.0PREDICTED: NAC domain-containing protein 100-like isoform X1
SwissprotQ9FLJ21e-118NC100_ARATH; NAC domain-containing protein 100
TrEMBLK4BL871e-159K4BL87_SOLLC; Uncharacterized protein
STRINGSolyc03g115850.2.11e-158(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-119NAC domain containing protein 100